PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.098700.1
Common NameCsa_1G046820, LOC101206413
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 378aa    MW: 42093.7 Da    PI: 6.9236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.098700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++++++G g+W+++++  g+ R++k+c++rw +yl
   Cucsa.098700.1 14 KGLWSPEEDEKLFNYITRFGVGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding45.71.5e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++++E++l++ +++ lG++ W+ Ia+ ++ gRt++++k++w++
   Cucsa.098700.1  67 RGMFSQQEEDLIISLHEVLGNR-WAQIAAQLP-GRTDNEIKNFWNS 110
                      788*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.6E-25664IPR009057Homeodomain-like
PROSITE profilePS5129424.074965IPR017930Myb domain
SuperFamilySSF466897.11E-2912108IPR009057Homeodomain-like
SMARTSM007174.1E-121363IPR001005SANT/Myb domain
PfamPF002492.4E-141461IPR001005SANT/Myb domain
CDDcd001674.98E-111761No hitNo description
Gene3DG3DSA:1.10.10.604.0E-2565116IPR009057Homeodomain-like
SMARTSM007171.6E-1366114IPR001005SANT/Myb domain
PROSITE profilePS5129419.04666116IPR017930Myb domain
PfamPF002491.5E-1367110IPR001005SANT/Myb domain
CDDcd001672.33E-1070112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGRHSCCLKQ KLRKGLWSPE EDEKLFNYIT RFGVGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGMF SQQEEDLIIS LHEVLGNRWA QIAAQLPGRT DNEIKNFWNS SLKKKLMKQG  120
IDPNTHKPII NIQEIKEKKI FEDREFPQIP PVQGVLGGGG GISAVGGNQG PAFLLGGTDY  180
YDGGLTTTPI RDHLMNSKQA NLVDSLCFFE FQTGQLDSSC SYNNNNNNTN FETQYQTNVQ  240
SFGFNSVPSL TNSDHGSLSG TEFSENSGSN ISNYGGFYMN NNNNNNGAVD NSTFCSWENE  300
NNKLESYFQI EVNNNNNNNN NNNGIKSEEL KRVAGGGSSM FDGQLIQSRS SIDFSSYPLM  360
SLSQHITAAN FGVFHHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004152489.20.0PREDICTED: transcription factor MYB86-like
TrEMBLA0A0A0LRA30.0A0A0A0LRA3_CUCSA; Uncharacterized protein
STRINGPOPTR_0015s09430.11e-132(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF58313353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.18e-80myb domain protein 86
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]